PDB entry 2m0y

View 2m0y on RCSB PDB site
Description: Solution structure of the SH3 domain of DOCK180
Class: apoptosis
Keywords: apoptosis
Deposited on 2012-11-08, released 2012-12-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dedicator of cytokinesis protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: DOCK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2m0ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2m0yA (A:)
mtrwvptkreekygvafynydargadelslqigdtvhiletyegwyrgytlrkkskkgif
pasyihlkeaiveg