PDB entry 2m0g

View 2m0g on RCSB PDB site
Description: Structure, phosphorylation and U2AF65 binding of the Nterminal Domain of splicing factor 1 during 3 splice site Recognition
Class: splicing
Keywords: spliceosome assembly, SF1, UHM, ULM, SPLICING
Deposited on 2012-10-25, released 2013-01-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Splicing factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SF1, ZFM1, ZNF162
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15637 (0-144)
      • engineered mutation (136)
  • Chain 'B':
    Compound: splicing factor u2af 65 kda subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: U2AF2, U2AF65
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2m0gb_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m0gB (B:)
    ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgk
    ifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw