PDB entry 2m0c

View 2m0c on RCSB PDB site
Description: Solution NMR Structure of Homeobox Domain of Human ALX4, Northeast Structural Genomics Consortium (NESG) Target HR4490C
Class: gene regulation
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, PSI-Biology, Protein Structure Initiative, GENE REGULATION
Deposited on 2012-10-24, released 2012-11-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein aristaless-like 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ALX4, KIAA1788
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H161 (3-74)
      • expression tag (0-2)
    Domains in SCOPe 2.04: d2m0ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m0cA (A:)
    shmsnkgkkrrnrttftsyqleelekvfqkthypdvyareqlamrtdltearvqvwfqnr
    rakwrkrerfgqmqq