PDB entry 2lyv

View 2lyv on RCSB PDB site
Description: Solution structure of the two RRM domains of hnRNP A1 (UP1) using segmental isotope labeling
Class: splicing, transport protein
Keywords: splicing, UP1, hnRNP A1, TRANSPORT PROTEIN
Deposited on 2012-09-19, released 2012-12-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heterogeneous nuclear ribonucleoprotein a1
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRNPA1, HNRPA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09651 (2-196)
      • expression tag (1)
    Domains in SCOPe 2.06: d2lyva1, d2lyva2, d2lyva3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lyvA (A:)
    ggsksespkepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgf
    vtyatveevdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteeh
    hlrdyfeqygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrk
    alskqemasasssqrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lyvA (A:)
    gsksespkepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfv
    tyatveevdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehh
    lrdyfeqygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrka
    lskqemasasssqrgr