PDB entry 2lxu

View 2lxu on RCSB PDB site
Description: Solution NMR Structure of the eukaryotic RNA recognition motif, RRM1, from the heterogeneous nuclear ribonucleoprotein H from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8614A
Class: RNA binding protein
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein Structure Initiative, RNA BINDING PROTEIN
Deposited on 2012-08-31, released 2012-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heterogeneous nuclear ribonucleoprotein H
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRNPH1, HNRPH, HNRPH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31943 (3-107)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d2lxua1, d2lxua2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lxuA (A:)
    shmggegfvvkvrglpwscsadevqrffsdckiqngaqgirfiytregrpsgeafveles
    edevklalkkdretmghryvevfksnnvemdwvlkhtgpnspdtandg