PDB entry 2lxi

View 2lxi on RCSB PDB site
Description: NMR structure of the N-terminal RNA Binding domain 1 (RRM1) of the protein RBM10 from Homo sapiens
Class: RNA binding protein
Keywords: RNA binding, RNA BINDING PROTEIN
Deposited on 2012-08-27, released 2012-10-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 10
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM10, DXS8237E, GPATC9, GPATCH9, KIAA0122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2lxia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lxiA (A:)
    snivmlrmlpqaateddirgqlqshgvqarevrlmrnkssgqsrgfafvefshlqdatrw
    meanqhslnilgqkvsmhysdpkpkinedwl