PDB entry 2lxc

View 2lxc on RCSB PDB site
Description: Solution structure of the complex between the Sgt2 homodimerization domain and the Get5 UBL domain
Class: protein binding/protein binding
Keywords: ubiquitin-like domain, protein-protein interaction, four-helix bundle, GET pathway, PROTEIN BINDING-PROTEIN BINDING complex
Deposited on 2012-08-19, released 2012-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-like protein mdy2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: GET5, MDY2, TMA24, YOL111C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12285 (1-78)
      • initiating methionine (0)
      • expression tag (79-80)
    Domains in SCOPe 2.07: d2lxca1, d2lxca2
  • Chain 'B':
    Compound: Small glutamine-rich tetratricopeptide repeat-containing protein 2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SGT2, UNF346, YOR007C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12118 (3-73)
      • expression tag (0-2)
  • Chain 'C':
    Compound: Small glutamine-rich tetratricopeptide repeat-containing protein 2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SGT2, UNF346, YOR007C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12118 (3-73)
      • expression tag (0-2)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lxcA (A:)
    mvhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnlfl
    sdlkvtpanstitvmikpnle
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.