PDB entry 2lum

View 2lum on RCSB PDB site
Description: Three-State Ensemble obtained from eNOEs of the Third Immunoglobulin Binding Domain of Protein G (GB3)
Class: protein binding
Keywords: correlated dynamics, NOE, eNOE, exact nuclear Overhauser effect, structure calculation, structure ensemble, PROTEIN BINDING
Deposited on 2012-06-18, released 2012-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d2luma1, d2luma2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lumA (A:)
    mqyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte