PDB entry 2lul

View 2lul on RCSB PDB site
Description: Solution NMR Structure of PH Domain of Tyrosine-protein kinase Tec from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR3504C
Class: transferase
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, PSI-Biology, Protein Structure Initiative, TRANSFERASE
Deposited on 2012-06-15, released 2012-08-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein kinase tec
    Species: Homo sapiens [TaxId:9606]
    Gene: PSCTK4, TEC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42680 (10-163)
      • expression tag (0-9)
    Domains in SCOPe 2.04: d2lula_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lulA (A:)
    mghhhhhhshmnfntileeilikrsqqkkktsplnykerlfvltksmltyyegraekkyr
    kgfidvskikcveivknddgvipcqnkypfqvvhdantlyifapspqsrdlwvkklkeei
    knnnnimikyhpkfwtdgsyqccrqteklapgcekynlfessir