PDB entry 2lss

View 2lss on RCSB PDB site
Description: Solution structure of the R. rickettsii cold shock-like protein
Class: RNA binding protein, DNA binding protein
Keywords: cold shock-like protein, CSD, Csp, oligonucleotide binding fold, OB fold, RNA BINDING PROTEIN, DNA BINDING PROTEIN
Deposited on 2012-05-04, released 2012-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cold shock-like protein
    Species: Rickettsia rickettsii [TaxId:392021]
    Gene: A1G_05630
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2lssa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lssA (A:)
matnivgkvkwynstknfgfieqdnggkdvfvhksavdaaglhsleegqdvifdleekqg
kayavnlrik