PDB entry 2ls8

View 2ls8 on RCSB PDB site
Description: Solution structure of human C-type lectin domain family 4 member D
Class: immune system
Keywords: STRUCTURAL GENOMICS, New York Structural Genomics Research Consortium, NYSGRC, PSI-Biology, IMMUNE SYSTEM
Deposited on 2012-04-23, released 2012-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member D
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC4D, CLECSF8, MCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WXI8 (2-133)
      • expression tag (0-1)
      • expression tag (134-141)
    Domains in SCOPe 2.07: d2ls8a1, d2ls8a2, d2ls8a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ls8A (A:)
    mvcpidwrafqsncyfpltdnktwaeserncsgmgahlmtisteaeqnfiiqfldrrlsy
    flglrdenakgqwrwvdqtpfnprrvfwhknepdnsqgencvvlvynqdkwawndvpcnf
    easrickipgttlnaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ls8A (A:)
    mvcpidwrafqsncyfpltdnktwaeserncsgmgahlmtisteaeqnfiiqfldrrlsy
    flglrdenakgqwrwvdqtpfnprrvfwhknepdnsqgencvvlvynqdkwawndvpcnf
    easrickipgttlnaenlyfqs