PDB entry 2ls5

View 2ls5 on RCSB PDB site
Description: Solution structure of a putative protein disulfide isomerase from Bacteroides thetaiotaomicron
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, THIOREDOXIN-LIKE, New York Structural Genomics Research Consortium, NYSGRC, PSI-Biology
Deposited on 2012-04-20, released 2012-05-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Bacteroides thetaiotaomicron [TaxId:226186]
    Gene: BT_1583
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A7E1 (3-150)
      • expression tag (0-2)
      • expression tag (151-158)
    Domains in SCOPe 2.08: d2ls5a1, d2ls5a2, d2ls5a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ls5A (A:)
mslgyivrigemapdftitltdgkqvtlsslrgkvvmlqftaswcgvcrkempfiekdiw
lkhkdnadfaligidrdeplekvlafakstgvtyplgldpgadifakyalrdagitrnvl
idregkivkltrlyneeefaslvqqinemlkeghhhhhh