PDB entry 2lqr

View 2lqr on RCSB PDB site
Description: NMR structure of Ig3 domain of palladin
Class: protein binding
Keywords: actin binding protein, immunoglubulin, PROTEIN BINDING
Deposited on 2012-03-13, released 2013-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: palladin
    Species: Mus musculus [TaxId:10090]
    Gene: Palld, Kiaa0992
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ET54 (3-107)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d2lqra1, d2lqra2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lqrA (A:)
    ggsnatapffemklkhykifegmpvtftcrvagnpkpkiywfkdgkqispksdhytiqrd
    ldgtcslhttastldddgnytimaanpqgrvsctgrlmvqavnqrgrs