PDB entry 2lqp

View 2lqp on RCSB PDB site
Description: NMR solution structure of the Ca2+-Calmodulin C-terminal domain in a complex with a peptide (NSCaTE) from the L-type Voltage-Gated Calcium Channel alpha1C subunit
Class: metal binding protein
Keywords: NSCaTE, METAL BINDING PROTEIN
Deposited on 2012-03-10, released 2012-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: CALM1, CALM, CAM, CAM1, CALM2, CAM2, CAMB, CALM3, CALML2, CAM3, CAMC, CAMIII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2lqpa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lqpA (A:)
    dtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvn
    yeefvqmmtak