PDB entry 2lqh

View 2lqh on RCSB PDB site
Description: NMR structure of FOXO3a transactivation domains (CR2C-CR3) in complex with CBP KIX domain (2b3l conformation)
Class: transcription
Keywords: promiscuous binding, intrinsic disorder, transcription
Deposited on 2012-03-06, released 2012-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2lqha_
  • Chain 'B':
    Compound: Forkhead box O3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2LQH (0-51)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lqhA (A:)
    gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans
    rdeyyhllaekiykiqkeleekrrsrl
    

  • Chain 'B':
    No sequence available.