PDB entry 2lns

View 2lns on RCSB PDB site
Description: Solution structure of AGR2 residues 41-175
Class: isomerase
Keywords: Anterior-gradient Protein 2, Thioredoxin-fold, cancer, adhesion, metastasis, ISOMERASE
Deposited on 2012-01-04, released 2013-01-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anterior gradient protein 2 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: AGR2, AG2, UNQ515/PRO1030
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95994 (5-139)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d2lnsa1, d2lnsa2
  • Chain 'B':
    Compound: Anterior gradient protein 2 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: AGR2, AG2, UNQ515/PRO1030
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95994 (5-139)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d2lnsb1, d2lnsb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lnsA (A:)
idpftpqtlsrgwgdqliwtqtyeealyksktsnkplmiihhldecphsqalkkvfaenk
eiqklaeqfvllnlvyettdkhlspdgqyvprimfvdpsltvraditgrysnrlyayepa
dtallldnmkkalkllktel

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lnsB (B:)
idpftpqtlsrgwgdqliwtqtyeealyksktsnkplmiihhldecphsqalkkvfaenk
eiqklaeqfvllnlvyettdkhlspdgqyvprimfvdpsltvraditgrysnrlyayepa
dtallldnmkkalkllktel