PDB entry 2lnb

View 2lnb on RCSB PDB site
Description: Solution NMR structure of N-terminal domain (6-74) of human ZBP1 protein, Northeast Structural Genomics Consortium Target HR8174A.
Class: immune system
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-BIOLOGY, Protein Structure Initiative, IMMUNE SYSTEM
Deposited on 2011-12-20, released 2012-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Z-DNA-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: C20orf183, DLM1, ZBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H171 (11-79)
      • expression tag (0-10)
    Domains in SCOPe 2.07: d2lnba1, d2lnba2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lnbA (A:)
    mghhhhhhshmadpgreghleqrilqvlteagspvklaqlvkecqapkrelnqvlyrmkk
    elkvsltspatwclggtdpe