PDB entry 2lmu

View 2lmu on RCSB PDB site
Description: Androcam at high calcium
Class: metal binding protein
Keywords: spermatogenesis, METAL BINDING PROTEIN
Deposited on 2011-12-12, released 2012-08-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calmodulin-related protein 97A
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: And, Camr97A, CG17769
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lmua_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lmuA (A:)
    mselteeqiaefkdafvqfdkegtgkiatrelgtlmrtlgqnpteaelqdliaeaennnn
    gqlnftefcgimakqmretdteeemreafkifdrdgdgfispaelrfvminlgekvtdee
    idemireadfdgdgminyeefvwmisqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lmuA (A:)
    selteeqiaefkdafvqfdkegtgkiatrelgtlmrtlgqnpteaelqdliaeaennnng
    qlnftefcgimakqmretdteeemreafkifdrdgdgfispaelrfvminlgekvtdeei
    demireadfdgdgminyeefvwmisqk