PDB entry 2lmi

View 2lmi on RCSB PDB site
Description: NMR structure of the protein BC040485 from Homo sapiens
Class: RNA binding protein
Keywords: G-rich RNA sequence binding factor, RNA binding domain, Structural Genomics, Joint Center for Structural Genomics, JCSG, PSI-Biology, RNA BINDING PROTEIN, Partnership for T-Cell Biology
Deposited on 2011-12-01, released 2011-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G-rich sequence factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GRSF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12849 (1-106)
      • expression tag (0)
    Domains in SCOPe 2.07: d2lmia1, d2lmia2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lmiA (A:)
    gskleeevddvfliraqglpwsctmedvlnffsdcrirngengihfllnrdgkrrgdali
    emeseqdvqkalekhrmymgqryvevyeinnedvdalmkslqvkssp