PDB entry 2lln

View 2lln on RCSB PDB site
Description: Solution structure of Thermus thermophilus apo-CuA
Class: oxidoreductase
Keywords: entatic state, electron transfer, OXIDOREDUCTASE
Deposited on 2011-11-15, released 2012-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:274]
    Gene: cbaB, ctaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98052 (1-125)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d2llna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2llnA (A:)
    mvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgae
    ivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnmfg
    tivvke