PDB entry 2liv

View 2liv on RCSB PDB site
Description: periplasmic binding protein structure and function. refined x-ray structures of the leucine/isoleucine/valine-binding protein and its complex with leucine
Deposited on 1989-04-10, released 1989-07-12
The last revision prior to the SCOP 1.69 freeze date was dated 1989-07-12, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.179
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d2liv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2liv_ (-)
    edikvavvgamsgpvaqygdqeftgaeqavadinakggikgnklqiakyddacdpkqava
    vankvvndgikyvighlcssstqpasdiyedegilmitpaatapeltargyqlilrttgl
    dsdqgptaakyilekvkpqriaivhdkqqygeglaravqdglkkgnanvvffdgitagek
    dfstlvarlkkenidfvyyggyhpemgqilrqaraaglktqfmgpegvanvslsniages
    aegllvtkpknydqvpankpivdaikakkqdpsgafvwttyaalqslqaglnqsddpaei
    akylkansvdtvmgpltwdekgdlkgfefgvfdwhangtatdak