PDB entry 2liv

View 2liv on RCSB PDB site
Description: periplasmic binding protein structure and function. refined x-ray structures of the leucine/isoleucine/valine-binding protein and its complex with leucine
Class: periplasmic binding protein
Keywords: periplasmic binding protein
Deposited on 1989-04-10, released 1989-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.179
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucine
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2liva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2livA (A:)
    edikvavvgamsgpvaqygdqeftgaeqavadinakggikgnklqiakyddacdpkqava
    vankvvndgikyvighlcssstqpasdiyedegilmitpaatapeltargyqlilrttgl
    dsdqgptaakyilekvkpqriaivhdkqqygeglaravqdglkkgnanvvffdgitagek
    dfstlvarlkkenidfvyyggyhpemgqilrqaraaglktqfmgpegvanvslsniages
    aegllvtkpknydqvpankpivdaikakkqdpsgafvwttyaalqslqaglnqsddpaei
    akylkansvdtvmgpltwdekgdlkgfefgvfdwhangtatdak