PDB entry 2lhm

View 2lhm on RCSB PDB site
Description: crystal structures of the apo-and holomutant human lysozymes with an introduced ca2+ binding site
Deposited on 1991-10-02, released 1992-04-15
The last revision prior to the SCOP 1.61 freeze date was dated 1992-04-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d2lhm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lhm_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallddniaddvacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv