PDB entry 2lhd

View 2lhd on RCSB PDB site
Description: GB98 solution structure
Class: De Novo protein
Keywords: De Novo protein
Deposited on 2011-08-08, released 2012-02-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gb98
    Species: artificial gene [TaxId:32630]
    Gene: PGB98
    Database cross-references and differences (RAF-indexed):
    • PDB 2LHD (0-55)
    Domains in SCOPe 2.04: d2lhda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lhdA (A:)
ttyklilnlkqakeeaikelvdagtaekyfklianaktvegvwtykdeiktftvte