PDB entry 2lhc

View 2lhc on RCSB PDB site
Description: Ga98 solution structure
Class: De Novo protein
Keywords: De Novo protein
Deposited on 2011-08-08, released 2012-02-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ga98
  Species: artificial gene [TaxId:32630]
  Gene: PGA98
  Database cross-references and differences (RAF-indexed):
  • PDB 2LHC (0-55)
  Domains in SCOPe 2.04: d2lhca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2lhcA (A:)
  ttyklilnlkqakeeaikelvdagtaekyfklianaktvegvwtlkdeiktftvte