PDB entry 2lh7

View 2lh7 on RCSB PDB site
Description: x-ray structural investigation of leghemoglobin. vi. structure of acetate-ferrileghemoglobin at a resolution of 2.0 angstroms (russian)
Deposited on 1982-04-23, released 1983-01-20
The last revision prior to the SCOP 1.65 freeze date was dated 1986-07-14, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d2lh7__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lh7_ (-)
    galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
    qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
    vvgakwseelnsawtiaydelaivikkemddaa