PDB entry 2lh6

View 2lh6 on RCSB PDB site
Description: x-ray structural investigation of leghemoglobin. vi. structure of acetate-ferrileghemoglobin at a resolution of 2.0 angstroms (russian)
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1982-04-23, released 1983-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leghemoglobin a (nicotinate met)
    Species: Lupinus luteus [TaxId:3873]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02240 (0-152)
      • conflict (78)
      • conflict (149)
    Domains in SCOPe 2.08: d2lh6a_
  • Heterogens: HEM, NIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lh6A (A:)
    galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
    qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
    vvgakwseelnsawtiaydelaivikkemddaa