PDB entry 2lh1

View 2lh1 on RCSB PDB site
Description: x-ray structural investigation of leghemoglobin. vi. structure of acetate-ferrileghemoglobin at a resolution of 2.0 angstroms (russian)
Deposited on 1982-04-23, released 1983-01-20
The last revision prior to the SCOP 1.57 freeze date was dated 1983-09-30, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d2lh1__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2lh1_ (-)
  galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
  qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
  vvgakwseelnsawtiaydelaivikkemddaa