PDB entry 2lgv

View 2lgv on RCSB PDB site
Description: Rbx1
Class: ligase
Keywords: ROC1, RING, Zn-binding, LIGASE
Deposited on 2011-08-02, released 2012-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase RBX1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBX1, RNF75, ROC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62877 (3-99)
      • expression tag (0-2)
      • engineered mutation (18)
      • engineered mutation (21)
      • engineered mutation (23-24)
    Domains in SCOPe 2.07: d2lgva1, d2lgva2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lgvA (A:)
    ggggtnsgagkkrfevkksnasaqsawdivvdncaicrnhimdlciecqanqasatseec
    tvawgvcnhafhfhcisrwlktrqvcpldnrewefqkygh