PDB entry 2lec

View 2lec on RCSB PDB site
Description: Solution structure of human SRSF2 (SC35) RRM in complex with 5'-UGGAGU-3'
Class: RNA binding protein/RNA
Keywords: SR protein, splicing factor, RNA protein complex, RNA binding protein-RNA complex
Deposited on 2011-06-15, released 2011-11-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/arginine-rich splicing factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SFRS2, SRSF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2leca_
  • Chain 'B':
    Compound: RNA (5'-r(*up*gp*gp*ap*gp*u)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lecA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmsygrpppdvegmtslkvdnltyrts
    pdtlrrvfekygrvgdvyiprdrytkesrgfafvrfhdkrdaedamdamdgavldgrelr
    vqmarygrppdshhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lecA (A:)
    msygrpppdvegmtslkvdnltyrtspdtlrrvfekygrvgdvyiprdrytkesrgfafv
    rfhdkrdaedamdamdgavldgrelrvqmarygrppdshhs
    

  • Chain 'B':
    No sequence available.