PDB entry 2le9

View 2le9 on RCSB PDB site
Description: RAGEC2-S100A13 tetrameric complex
Class: membrane protein/metal binding protein
Keywords: Receptor for Advanced Glycation End products, S100A13, tetrameric complex, MEMBRANE PROTEIN-METAL BINDING PROTEIN complex
Deposited on 2011-06-14, released 2012-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Advanced glycosylation end product-specific receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: AGER, RAGE, RAGEC2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protein S100-A13
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2le9b_
  • Chain 'C':
    Compound: Protein S100-A13
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2le9c_
  • Chain 'D':
    Compound: Advanced glycosylation end product-specific receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: AGER, RAGE, RAGEC2
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2le9B (B:)
    aaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekmk
    sldvnqdselkfneywrligelakeirkkkdlkirkk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2le9C (C:)
    aaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekmk
    sldvnqdselkfneywrligelakeirkkkdlkirkk
    

  • Chain 'D':
    No sequence available.