PDB entry 2ldn

View 2ldn on RCSB PDB site
Description: Solution structure of FGF1-SSR128129E
Class: protein transport
Keywords: Fibroblast growth factor, Beta sheet protein, Protein-drug complex, PROTEIN TRANSPORT
Deposited on 2011-05-30, released 2012-06-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: heparin-binding growth factor 1
  Species: Homo sapiens [TaxId:9606]
  Gene: FGF
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05230 (0-129)
  Domains in SCOPe 2.06: d2ldna_
• Heterogens: SSF

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ldnA (A:)
  ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
  dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
  kailflplpv