PDB entry 2ldk

View 2ldk on RCSB PDB site
Description: Solution NMR Structure of Protein AAur_3427 from Arthrobacter aurescens, Northeast Structural Genomics Consortium Target AaR96
Class: structural genomics, unknown function
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein Structure Initiative, UNKNOWN FUNCTION
Deposited on 2011-05-27, released 2011-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Uncharacterized protein
  Species: Arthrobacter aurescens [TaxId:290340]
  Gene: AAur_3427
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1RA60 (0-163)
    • expression tag (164-171)
  Domains in SCOPe 2.08: d2ldka1, d2ldka2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ldkA (A:)
  tvvsvdkdvealsfsivaefdadvkrvwaiwedprqlerwwgpptwpatfetheftvggk
  aayymtgpdgtkargwwqfttieapdhlefddgfadehgapvdelgvthatvkleplenr
  trmtiistfeseeqmqkmaemgmeegmreaieqidavlsepanalehhhhhh