PDB entry 2ld5

View 2ld5 on RCSB PDB site
Description: Solution NMR-derived complex structure of Hoxa13 DNA binding domain bound to DNA
Class: transcription/DNA
Keywords: TRANSCRIPTION-DNA complex
Deposited on 2011-05-14, released 2011-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein Hox-A13
    Species: Mus musculus [TaxId:10090]
    Gene: Hox-1.10, Hoxa13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ld5a_
  • Chain 'B':
    Compound: DNA (5'-d(*cp*ap*ap*ap*tp*ap*ap*ap*ap*tp*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(p*gp*ap*tp*tp*tp*tp*ap*tp*tp*tp*g)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ld5A (A:)
    hmlegrkkrvpytkvqlkelereyatnkfitkdkrrrisattnlserqvtiwfqnrrvke
    kkvinklktts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ld5A (A:)
    grkkrvpytkvqlkelereyatnkfitkdkrrrisattnlserqvtiwfqnrrvkekkvi
    nklktts
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.