PDB entry 2lcw

View 2lcw on RCSB PDB site
Description: solution structure of FUS/TLS RRM domain
Class: RNA binding protein
Keywords: RRM, Nucleic acid binding protein, RNA BINDING PROTEIN
Deposited on 2011-05-10, released 2012-06-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein FUS
    Species: Homo sapiens [TaxId:9606]
    Gene: FUS, TLS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2lcwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lcwA (A:)
    eqdnsdnntifvqglgenvtiesvadyfkqigiiktnkktgqpminlytdretgklkgea
    tvsfddppsakaaidwfdgkefsgnpikvsfatrradfnrgggngrgglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lcwA (A:)
    eqdnsdnntifvqglgenvtiesvadyfkqigiiktnkktgqpminlytdretgklkgea
    tvsfddppsakaaidwfdgkefsgnpikvsfatrradfnrgggngrgg