PDB entry 2lcf

View 2lcf on RCSB PDB site
Description: Solution structure of GppNHp-bound H-RasT35S mutant protein
Class: signaling protein
Keywords: Ras, SIGNALING PROTEIN, GTP-bound form, Conformational states
Deposited on 2011-04-28, released 2011-09-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (6-171)
      • engineered mutation (40)
    Domains in SCOPe 2.05: d2lcfa_
  • Heterogens: GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lcfA (A:)
    gplgsdmteyklvvvgaggvgksaltiqliqnhfvdeydpsiedsyrkqvvidgetclld
    ildtagqeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlv
    gnkcdlaartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lcfA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydpsiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh