PDB entry 2lc5

View 2lc5 on RCSB PDB site
Description: Calmodulin-like Protein from Entamoeba histolytica: Solution Structure and Calcium-Binding Properties of a Partially Folded Protein
Class: metal binding protein
Keywords: ehcam, ca-binding protein, entamoeba histolytica, partially structured protein, cam-like, metal binding protein
Deposited on 2011-04-23, released 2011-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-06-08, with a file datestamp of 2011-06-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calmodulin, putative
    Species: Entamoeba histolytica [TaxId:294381]
    Gene: EHI_100270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lc5a_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lc5A (A:)
    mseqkkvltaeeqqeykeafqlfdkdndnkltaeelgtvmralganptkqkiseivkdyd
    kdnsgkfdqetfltimleygqevds