PDB entry 2lbp

View 2lbp on RCSB PDB site
Description: structure of the l-leucine-binding protein refined at 2.4 angstroms resolution and comparison with the leu(slash)ile(slash)val-binding protein structure
Class: periplasmic binding protein
Keywords: periplasmic binding protein
Deposited on 1989-04-10, released 1989-07-12
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucine-binding protein
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04816 (0-345)
      • conflict (343)
    Domains in SCOP 1.75: d2lbpa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lbpA (A:)
    ddikvavvgamsgpiaqwgimefngaeqaikdinakggikgdklvgveyddacdpkqava
    vankivndgikyvighlcssstqpasdiyedegilmispgatapeltqrgyqhimrtagl
    dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek
    dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda
    aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl
    alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak