PDB entry 2la6

View 2la6 on RCSB PDB site
Description: Solution NMR Structure of RRM domain of RNA-binding protein FUS from homo sapiens, Northeast Structural Genomics Consortium Target HR6430A
Class: RNA binding protein
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein Structure Initiative, RNA recognition, RNA BINDING PROTEIN, Methods development
Deposited on 2011-03-04, released 2011-05-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein FUS
    Species: Homo sapiens [TaxId:9606]
    Gene: FUS, TLS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35637 (10-98)
      • expression tag (0-9)
    Domains in SCOPe 2.04: d2la6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2la6A (A:)
    mghhhhhhshsdnntifvqglgenvtiesvadyfkqigiiktnkktgqpminlytdretg
    klkgeatvsfddppsakaaidwfdgkefsgnpikvsfat