PDB entry 2la4

View 2la4 on RCSB PDB site
Description: NMR structure of the C-terminal RRM domain of poly(U) binding 1
Class: RNA binding protein
Keywords: RRM, RNA recognition, Stress granules, Nucleus, RNA-binding, Transcription, RNA BINDING PROTEIN
Deposited on 2011-03-01, released 2011-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PUB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32588 (1-100)
      • expression tag (0)
    Domains in SCOPe 2.07: d2la4a1, d2la4a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2la4A (A:)
    gsqtiglppqvnpqavdhiirsapprvttayigniphfateadliplfqnfgfildfkhy
    pekgccfikydtheqaavcivalanfpfqgrnlrtgwgker