PDB entry 2l5x

View 2l5x on RCSB PDB site
Description: Solution structure of IL1A-S100A13 complex
Class: cytokine/transport protein
Keywords: Protein-protein complex, key component in non-classical pathway of IL-1a, Interleukin-1alpha, S100A13, CYTOKINE-TRANSPORT PROTEIN complex
Deposited on 2010-11-09, released 2011-01-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-1 alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL1A, IL1F1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2l5xa_
  • Chain 'B':
    Compound: Protein S100-A13
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2l5xb_
  • Chain 'C':
    Compound: Protein S100-A13
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2l5xc_
  • Chain 'D':
    Compound: interleukin-1 alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL1A, IL1F1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2l5xd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l5xA (A:)
    nvkynfmriikyefilndalnqsiirandqyltaaalhnldeavkfdmgayksskddaki
    tvilrisktqlyvtaqdedqpvllkempeipktitgsetnllffwethgtknyftsvahp
    nlfiatkqdywvclaggppsitdfqilenqa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l5xB (B:)
    maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
    ksldvnqdselkfneywrligelakeirkkkdlkirkk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l5xC (C:)
    maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
    ksldvnqdselkfneywrligelakeirkkkdlkirkk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l5xD (D:)
    nvkynfmriikyefilndalnqsiirandqyltaaalhnldeavkfdmgayksskddaki
    tvilrisktqlyvtaqdedqpvllkempeipktitgsetnllffwethgtknyftsvahp
    nlfiatkqdywvclaggppsitdfqilenqa