PDB entry 2l5u

View 2l5u on RCSB PDB site
Description: Structure of the first PHD finger (PHD1) from CHD4 (Mi2b)
Class: metal binding protein
Keywords: CHD4, Mi2b, Mi2-beta, PHD, PROTEIN BINDING, peptide binding protein, METAL BINDING PROTEIN
Deposited on 2010-11-08, released 2011-01-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromodomain-helicase-DNA-binding protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: CHD4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14839 (5-60)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d2l5ua1, d2l5ua2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l5uA (A:)
    gplgsyetdhqdycevcqqggeiilcdtcprayhmvcldpdmekapegkwscphcekegi
    q