PDB entry 2l4b

View 2l4b on RCSB PDB site
Description: Solution structure of a putative acyl carrier protein from Anaplasma phagocytophilum. Seattle Structural Genomics Center for Infectious Disease target AnphA.01018.a
Class: transferase
Keywords: infectious disease, Human granulocytic anaplasmosis, SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2010-10-02, released 2010-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Anaplasma phagocytophilum [TaxId:212042]
    Gene: APH_0929
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2GJE9 (5-87)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d2l4ba1, d2l4ba2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l4bA (A:)
    pgsmvseeikaqvmesvigclklndeqkqilsgttnlakdfnldsldfvdlimsleerfs
    leisdedaqkletvddicryiaskssda