PDB entry 2l3c

View 2l3c on RCSB PDB site
Description: Solution structure of ADAR2 dsRBM1 bound to LSL RNA
Class: Hydrolase/RNA
Keywords: editing, dsRNA recognition, dsRBM, Hydrolase-RNA complex
Deposited on 2010-09-12, released 2010-10-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Double-stranded RNA-specific editase 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Adarb1, Red1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2l3ca_
  • Chain 'B':
    Compound: RNA (34-mer)
    Species: Rattus norvegicus [TaxId:10116]

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l3cA (A:)
    pgpvlpknalmqlneikpglqymllsqtgpvhaplfvmsvevngqvfegsgptkkkaklh
    aaekalrsfvqfpn
    

  • Chain 'B':
    No sequence available.