PDB entry 2l05

View 2l05 on RCSB PDB site
Description: Solution NMR Structure of the Ras-binding domain of Serine/threonine-protein kinase B-raf from Homo sapiens, Northeast Structural Genomics Consortium Target HR4694F
Class: transferase
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-2, Protein Structure Initiative, TRANSFERASE
Deposited on 2010-06-30, released 2010-07-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15056 (11-94)
      • expression tag (9-10)
    Domains in SCOPe 2.08: d2l05a1, d2l05a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2l05A (A:)
    mghhhhhhshmpkspqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccav
    yriqdgekkpigwdtdiswltgeelhvevlenvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2l05A (A:)
    hmpkspqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqdgekk
    pigwdtdiswltgeelhvevlenvpl