PDB entry 2l00

View 2l00 on RCSB PDB site
Description: Solution structure of the non-covalent complex of the ZNF216 A20 domain with ubiquitin
Class: metal binding protein/peptide binding protein
Keywords: A20 domain, ZNF216, ubiquitin, zinc finger, ubiquitin binding, METAL BINDING PROTEIN-PEPTIDE BINDING PROTEIN complex
Deposited on 2010-06-29, released 2011-07-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Zfand5 protein (Zinc finger protein 216 (Predicted), isoform CRA_a)
  Species: Rattus norvegicus [TaxId:10116]
  Gene: rCG_48158, Zfand5, Zfp216_predicted
  Database cross-references and differences (RAF-indexed):
  • Uniprot B5DF11
• Chain 'B':
  Compound: Ubiquitin
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: PUBI-2, UBI1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61864 (0-End)
  Domains in SCOPe 2.05: d2l00b_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2l00B (B:)
  mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
  iqkestlhlvlrlrgg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2l00B (B:)
  mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
  iqkestlhlvl