PDB entry 2kz2

View 2kz2 on RCSB PDB site
Description: Calmodulin, C-terminal domain, F92E mutant
Class: Metal Binding Protein
Keywords: Calmodulin, TR2C, Metal Binding Protein
Deposited on 2010-06-10, released 2011-04-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Gallus gallus [TaxId:9031]
    Gene: CALM, CAM, RCJMB04_24e7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62149 (21-93)
      • expression tag (1-20)
      • engineered mutation (37)
    Domains in SCOPe 2.06: d2kz2a1, d2kz2a2
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2kz2A (A:)
    sgshhhhhhgssgenlyfqslmkdtdseeeireafrvedkdgngyisaaelrhvmtnlge
    kltdeevdemireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kz2A (A:)
    gshhhhhhgssgenlyfqslmkdtdseeeireafrvedkdgngyisaaelrhvmtnlgek
    ltdeevdemireadidgdgqvnyeefvqmmtak