PDB entry 2kyx

View 2kyx on RCSB PDB site
Description: Solution structure of the RRM domain of CYP33
Class: isomerase
Keywords: cyp33, rrm, isomerase
Deposited on 2010-06-09, released 2010-08-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: peptidyl-prolyl cis-trans isomerase e
  Species: Homo sapiens [TaxId:9606]
  Gene: PPIE, CYP33
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UNP9 (2-82)
    • expression tag (0-1)
  Domains in SCOPe 2.06: d2kyxa1, d2kyxa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kyxA (A:)
  gsttkrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaeda
  aaaidnmneselfgrtirvnlak