PDB entry 2kxn

View 2kxn on RCSB PDB site
Description: NMR structure of human Tra2beta1 RRM in complex with AAGAAC RNA
Class: RNA binding protein/RNA
Keywords: SR protein, RRM, splicing factor, RNA protein complex, SMN, RNA binding protein-RNA complex
Deposited on 2010-05-10, released 2011-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-r(*ap*ap*gp*ap*ap*c)-3'
  • Chain 'B':
    Compound: Transformer-2 protein homolog beta
    Species: Homo sapiens [TaxId:9606]
    Gene: TRA2B, SFRS10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2kxnb_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2kxnB (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsrhvgnranpdpncclgvfglslytte
    rdlrevfskygpiadvsivydqqsrrsrgfafvyfenvddakeakerangmeldgrrirv
    dfsitkrph
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kxnB (B:)
    rhvgnranpdpncclgvfglslytterdlrevfskygpiadvsivydqqsrrsrgfafvy
    fenvddakeakerangmeldgrrirvdfsitkrph