PDB entry 2kxl

View 2kxl on RCSB PDB site
Description: Solution structure of a bacterial cyclic nucleotide-activated K+ channel binding domain in the unliganded state
Class: membrane protein
Keywords: Cyclic Nucleotide Binding Domain (CNBD), Ion Channel, Protein Phosphate Binding Cassette in the Apo State, helical portion, beta barrel core, MEMBRANE PROTEIN
Deposited on 2010-05-10, released 2011-04-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cyclic nucleotide-gated potassium channel mll3241
  Species: Mesorhizobium loti [TaxId:381]
  Gene: mll3241
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q98GN8 (2-141)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d2kxla1, d2kxla2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kxlA (A:)
  gsqevrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmf
  fvvegsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcss
  speiaeifrktalerrgaaasa